Protein Info for Dsui_1412 in Dechlorosoma suillum PS

Annotation: chromate transport protein ChrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 155 to 170 (16 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details PF02417: Chromate_transp" amino acids 25 to 186 (162 residues), 121.4 bits, see alignment E=1.9e-39

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 70% identity to dar:Daro_3386)

Predicted SEED Role

"Chromate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNG2 at UniProt or InterPro

Protein Sequence (199 amino acids)

>Dsui_1412 chromate transport protein ChrA (Dechlorosoma suillum PS)
MPEAGAQEQPGGGGGNSPAPVTCRQLFLGFSSVGISGFGGVLPFARRMLVEERRWLTAEE
FNSLLGLCQFLPGPNVANLSIAVGSRYQGIRGAIAAVSGLFGGPLLIVLLLGLLYDRYGQ
LPQVQGLLRGVAAVGCGLLFGTALRMGLALQVKRLFLPFTLAVFVAVALLRWPMPIVMVA
LLALAAGVAYAHLKRKGAP