Protein Info for Dsui_1409 in Dechlorosoma suillum PS

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 152 to 178 (27 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 3 to 291 (289 residues), 128.3 bits, see alignment E=1.8e-41 PF01545: Cation_efflux" amino acids 4 to 207 (204 residues), 145.7 bits, see alignment E=8.1e-47

Best Hits

KEGG orthology group: None (inferred from 55% identity to psu:Psesu_1878)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN19 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Dsui_1409 cation diffusion facilitator family transporter (Dechlorosoma suillum PS)
MSAIIYALSANAGIAASKAVAAAYTGSSAMLAEAVHSAADCANQLLLLLGIRQARREPTP
DHPLGFGKATYFWSFMVAIMLFSLGGAFSIYEGVHKLSHPEPLANPWVAIIVLGVGVLLE
AWSLRGCIHEIREKAGDMPLWRYFRDSRESELIVVMGEDIAALAGLTLALGAILLSLATG
NPAFDAWGSIAVGALLVVVAIGVGLEVKALLIGQSAEPAAHAAMEQWLRQRPEVETLYNL
ISFQMGSYLFVAVKARMAEQQSASGLIDQINAVQDALKASFPDVRWVFFEPDDKG