Protein Info for Dsui_1404 in Dechlorosoma suillum PS

Annotation: ABC-type multidrug transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 121 bits, see alignment E=6e-39 PF13304: AAA_21" amino acids 117 to 191 (75 residues), 31.2 bits, see alignment E=2.3e-11

Best Hits

KEGG orthology group: K09687, antibiotic transport system ATP-binding protein (inferred from 69% identity to reu:Reut_A3116)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN14 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Dsui_1404 ABC-type multidrug transport system, ATPase component (Dechlorosoma suillum PS)
MGTAVHFDRVAKRFGSLQALAGVSLEIAEGEFFGLLGPNGAGKTTLISCLAGLARPDAGS
VRVLGRDVVADYREARRLLGVVPQELVFDPFFSVRETLRIQSGYFGIRNNDAWIDEILEN
LDLTAKADTNMRRLSGGMKRRVLVAQALVHRPPVIVLDEPTAGVDVELRQGLWEFIRRLN
GEGHTIILTTHYLEEAETLCGRIGMLKQGQLVALDETASLLRQFSGHTLTLRLGQGDLPA
ALVPRLLSREGAVCRLRLAGFAELEQVLADLRQAGCGVADLKLDEPDLEEVFVRLMRGEV
SREAVQP