Protein Info for Dsui_1370 in Dechlorosoma suillum PS

Annotation: putative permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 135 to 152 (18 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 258 to 275 (18 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details PF00892: EamA" amino acids 22 to 152 (131 residues), 67.8 bits, see alignment E=5.7e-23 amino acids 172 to 297 (126 residues), 57.8 bits, see alignment E=6.7e-20

Best Hits

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMY0 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Dsui_1370 putative permease, DMT superfamily (Dechlorosoma suillum PS)
MNAIAPPLPAGIAAAPSRTRVLIAGIAFSVIWSSAFVAGRIGLDHAAPLTLLAIRFLAAG
LLFAFLARSSGRSLRLPTMAGRALLAGLVCNAAYLGLAYWGLQGVPTALTAVLVSACPLL
TLLLAAALEGERLTPLRLAGILLGMGGVLWITRHRLTVEQLEPLYLAAIGAGTLALALGT
VLSKKVAAGQDLIAAVTLQFMASGLVLLPLAWGLEGFRLEAHPALWGSLAYSVAVSLAST
LLMLWLLRHGQASSASSFHFLNPFFGTLFAVTLLGETMYADDLLGVLPIALGIALVAWKR