Protein Info for Dsui_1367 in Dechlorosoma suillum PS

Annotation: crcB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 56 (28 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details TIGR00494: protein CrcB" amino acids 7 to 120 (114 residues), 86.7 bits, see alignment E=7.2e-29 PF02537: CRCB" amino acids 7 to 119 (113 residues), 88.6 bits, see alignment E=1.6e-29

Best Hits

Swiss-Prot: 68% identical to CRCB_DECAR: Putative fluoride ion transporter CrcB (crcB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K06199, CrcB protein (inferred from 68% identity to dar:Daro_3446)

MetaCyc: 46% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMX7 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Dsui_1367 crcB protein (Dechlorosoma suillum PS)
MNWNAFLAIGVGAALGAWARWGLGLLLNPLFLAIPLGTLAANLLGGYLIGVALGVFHSYA
HLSPLLKLFLITGFLGGLTTFSSFSGEVMERLLAQQYAWAFGAIALHLLGSLAMTFLGLW
SVGVHRVWP