Protein Info for Dsui_1366 in Dechlorosoma suillum PS

Annotation: glutaminyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 PF00749: tRNA-synt_1c" amino acids 55 to 374 (320 residues), 338.6 bits, see alignment E=4.5e-105 TIGR00440: glutamine--tRNA ligase" amino acids 56 to 591 (536 residues), 690 bits, see alignment E=1.3e-211 PF03950: tRNA-synt_1c_C" amino acids 379 to 476 (98 residues), 96.7 bits, see alignment E=1.1e-31 PF20974: tRNA-synt_1c_C2" amino acids 496 to 568 (73 residues), 72.7 bits, see alignment E=5.2e-24

Best Hits

Swiss-Prot: 64% identical to SYQ_BORA1: Glutamine--tRNA ligase (glnS) from Bordetella avium (strain 197N)

KEGG orthology group: K01886, glutaminyl-tRNA synthetase [EC: 6.1.1.18] (inferred from 82% identity to dar:Daro_3447)

Predicted SEED Role

"Glutaminyl-tRNA synthetase (EC 6.1.1.18)" in subsystem tRNA aminoacylation, Glu and Gln (EC 6.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMX6 at UniProt or InterPro

Protein Sequence (593 amino acids)

>Dsui_1366 glutaminyl-tRNA synthetase (Dechlorosoma suillum PS)
MSNPNKNAAPIAPAANFIRNIVEADLAAGKHAQRRWAGQPGLASDHAAGALDPAKIRTRF
PPEPNGYLHFGHAKSICLNFGLARDYGGRCHLRFDDTNPEKEDQEYVDSIVDAVKWLGFN
WEDAQENNLYYASNYFPWMIQAAEYLIATGNAYVDSQSAEEMRANRGTLTEAGKDSPFRN
RSVAENQDLFKRMQAGEFPDGAHILRAKIDMAAPNINLRDPAIYRIRHATHHNTGDKYCV
YPMYTFAHPIEDALENITHSICTLEFEDQRPFYDWLLERLAEGGLLQRPLPHQYEFSRLN
LTYVVLSKRKLIQLVEEKHVDGWDDPRMPTLVGARRRGYTAEGFRLLMERVGVSKHDSLI
DYSLLEDCMRETMNELDERRIAVLDPLKLVITNYPEGQSEECFAPNHPLKPELGKRMVPF
SRELWIEREDFMEEPSKGYHRLYPGNMARLRYGFVVKCTGCEKDAAGNVTAVLCEYMEDS
KSGTPGADNYKVKGNLHWVSVAHAYTAEVRLYDRLFQAAAPGAGDRDFLDDLNPASKVAI
TVQLEPALKDALPEQRFQFERHGYFVADRVDSQPGAPVFNRAVTLKDSWGKAG