Protein Info for Dsui_1364 in Dechlorosoma suillum PS

Annotation: serine phosphatase RsbU, regulator of sigma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details PF00672: HAMP" amino acids 341 to 391 (51 residues), 49.2 bits, see alignment 5.3e-17 PF07228: SpoIIE" amino acids 465 to 661 (197 residues), 77.5 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: None (inferred from 47% identity to eba:ebA2797)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMX4 at UniProt or InterPro

Protein Sequence (665 amino acids)

>Dsui_1364 serine phosphatase RsbU, regulator of sigma subunit (Dechlorosoma suillum PS)
MPPLPAPVPPPQAGRAGWSLRSKTVGLLLAALLIGIRVAEDIRENLGTALARNHAQLTKQ
RILSAVGREMALAQRFAESTVLREWMTGEQDPAKTERFFREGEGFRRAFADQAYFAALAS
SRHFYFADPQAAPRAAMRYTADPANPDDAWFFATLKSSQGYSLNVDYDKKLQVTNVWINI
VVRDEGERPIGIAGTGLNLSRFLSNVLANRETGVVTMVLDQNGAIIAHPDPRQIAYATAG
NQNIEKTIYRLLERPADKEALRRTLVAAASDEGEGTPTLRLKLEGAPSLAAATYIPSLRW
TVLTAVDLNTSRVFDAPLITALALGSLLLLALLVGLYTAGLNRLVLAPLAALTAAVQRIG
AGHYGERLRSNRGDEIGALTRAFDTMAQQVRAHSENLERLVDERTRELAEAHRKVTDSIR
YASLIQHAILPDKALKADLQGQYFVLWRPRDVVGGDFYLYRGAAGQCLFGVVDCAGHGVP
GACMTMIAHAALEVALGDTPWQDPAALLQRTDQVARGMLPGDDRSRQIATSMDMGLCHVD
LERRLVTFAGARLGLFWSDGDNCEEIPGHRRGVNDRRSGSYDNAQVPLAAGRTFYLVSDG
LLDQAGGDQGYGFGARRLAAWIRTHAHLPLAEQKSALLEEIQAYQGPLAQRDDITLLAFR
FDDQR