Protein Info for Dsui_1352 in Dechlorosoma suillum PS

Annotation: acyl dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF01575: MaoC_dehydratas" amino acids 18 to 114 (97 residues), 90.3 bits, see alignment E=7.3e-30 PF13452: MaoC_dehydrat_N" amino acids 19 to 129 (111 residues), 32.3 bits, see alignment E=1e-11

Best Hits

Swiss-Prot: 70% identical to PHAJ_RHORT: (R)-specific enoyl-CoA hydratase (phaJ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: None (inferred from 75% identity to app:CAP2UW1_2503)

MetaCyc: 42% identical to (R)-specific enoyl-CoA hydratase (Pseudomonas oleovorans)
RXN-7699 [EC: 4.2.1.119]

Predicted SEED Role

"MaoC family protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.119

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMW2 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Dsui_1352 acyl dehydratase (Dechlorosoma suillum PS)
MNALNGYNIEDLQPGMSASTAKTVTEADIVLFAGITMDTNAVHMNEEFAKTTMFGGRIAH
GMLSVGFISAVLGTRLPGPGSIYLGQTLKFKAPVRPGDTVTATVTVKEVLVEKKRVVLDT
VCTVGGKPVIEGEATLMCTSSKG