Protein Info for Dsui_1346 in Dechlorosoma suillum PS

Annotation: dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 236 to 255 (20 residues), see Phobius details PF00899: ThiF" amino acids 20 to 256 (237 residues), 131.2 bits, see alignment E=1.7e-42

Best Hits

KEGG orthology group: None (inferred from 63% identity to mms:mma_2837)

Predicted SEED Role

"Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMV6 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Dsui_1346 dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis (Dechlorosoma suillum PS)
MNQIDSSPDYERRFGGVARLYGTQALARFRAAHVCVVGIGGVGSWSVEALARSGVGGLTL
IDLDHVAESNVNRQIHALEVTLGQAKIEAMAERVRQINPDCRLTLVDDFVEPDNLDALFG
ALPPVDYLVDAIDGVRAKTAMLAWCRRHDWPVVTAGAAGGQMDPTMIRVADLSRTVQDPL
LAKVRGQLRKSHGFPKDPKKKFGIDAVYSEEPLRYPDTACSAPVGGGAAGLNCAGFGSAV
TVTASFGLVAASVVLRRLAASV