Protein Info for Dsui_1345 in Dechlorosoma suillum PS

Annotation: magnesium Mg(2+) and cobalt Co(2+) transport protein CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 298 to 320 (23 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 63 to 353 (291 residues), 276.7 bits, see alignment E=1.4e-86 PF01544: CorA" amino acids 64 to 350 (287 residues), 233.5 bits, see alignment E=1.7e-73

Best Hits

Swiss-Prot: 47% identical to CORA_THEMA: Cobalt/magnesium transport protein CorA (corA) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 55% identity to mep:MPQ_0679)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMV5 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Dsui_1345 magnesium Mg(2+) and cobalt Co(2+) transport protein CorA (Dechlorosoma suillum PS)
MSHDKKLRSQKAGLEPGSLVHLGEVKTSTPTLMLLEYDSNGLYEQELSSREQIDGLVRRP
GCTLWLNVYGLQDPDLMAAIGKRFGLHPLVLEDILNTDQRPKVDDYEDYLYLVARLFDYV
PHSRQLASDQVSIILGKDFVLTFQERPSGTFGALRERLRANRNQVRRLGADYLAYSLLDS
LVDRYFALVEQVGDHAEILETSLINRRPRPGVLQSIHRHKRQITTLRRAIWPLREVLNVL
LRSHDGFFRAETVLYLRDVYDHTVHLIESLEDLRDLLTGLLDVYLSAVSNRVNMEVRALT
VVATIFMPATLIAGVFGMNFHVMPWLEHPDGFWFAMGLMGAIATIMLAAFWRRRLIG