Protein Info for Dsui_1328 in Dechlorosoma suillum PS

Annotation: ubiquinone biosynthesis protein COQ7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF03232: COQ7" amino acids 44 to 204 (161 residues), 144.1 bits, see alignment E=1.7e-46

Best Hits

Swiss-Prot: 67% identical to COQ7_DECAR: 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (coq7) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K06134, ubiquinone biosynthesis monooxygenase Coq7 [EC: 1.14.13.-] (inferred from 67% identity to dar:Daro_0647)

MetaCyc: 54% identical to 3-demethoxyubiquinol 3-hydroxylase (Xanthomonas campestris pv. campestris)
OCTAPRENYL-METHYL-METHOXY-BENZOQ-OH-RXN [EC: 1.14.99.60]

Predicted SEED Role

"Uncharacterized hydroxylase PA0655"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.99.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMF0 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Dsui_1328 ubiquinone biosynthesis protein COQ7 (Dechlorosoma suillum PS)
MSIDRLIVEFDKALRAVFAPAPTRRSVPGSDVPMPELSPEEKRHAAALMRVNHCGEICAQ
ALYQGQALTSKDVVIKQALEHAAWEETEHLAWTERRIQELGGRKSFLNPLWYAGSLALGV
VVGKAGDSWNLGFLAETERQVERHLDSHLRRLPLADQRSRSIVSQMKFDEMSHAQTAVSL
GGVDLPGPVRLAMKLSSKVMTGVAYYL