Protein Info for Dsui_1328 in Dechlorosoma suillum PS
Annotation: ubiquinone biosynthesis protein COQ7
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 67% identical to COQ7_DECAR: 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (coq7) from Dechloromonas aromatica (strain RCB)
KEGG orthology group: K06134, ubiquinone biosynthesis monooxygenase Coq7 [EC: 1.14.13.-] (inferred from 67% identity to dar:Daro_0647)MetaCyc: 54% identical to 3-demethoxyubiquinol 3-hydroxylase (Xanthomonas campestris pv. campestris)
OCTAPRENYL-METHYL-METHOXY-BENZOQ-OH-RXN [EC: 1.14.99.60]
Predicted SEED Role
"Uncharacterized hydroxylase PA0655"
MetaCyc Pathways
- superpathway of chorismate metabolism (48/59 steps found)
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
- ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
- ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
- ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
- ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
- ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
- ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
- superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
- ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Bisphenol A degradation
- Brassinosteroid biosynthesis
- Carotenoid biosynthesis - General
- Cyanoamino acid metabolism
- Flavonoid biosynthesis
- Histidine metabolism
- Isoflavonoid biosynthesis
- Limonene and pinene degradation
- Methane metabolism
- Naphthalene and anthracene degradation
- Phenylalanine metabolism
- Phenylpropanoid biosynthesis
- Styrene degradation
- Toluene and xylene degradation
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
- gamma-Hexachlorocyclohexane degradation
Isozymes
Compare fitness of predicted isozymes for: 1.14.13.-
Use Curated BLAST to search for 1.14.13.- or 1.14.99.60
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QMF0 at UniProt or InterPro
Protein Sequence (207 amino acids)
>Dsui_1328 ubiquinone biosynthesis protein COQ7 (Dechlorosoma suillum PS) MSIDRLIVEFDKALRAVFAPAPTRRSVPGSDVPMPELSPEEKRHAAALMRVNHCGEICAQ ALYQGQALTSKDVVIKQALEHAAWEETEHLAWTERRIQELGGRKSFLNPLWYAGSLALGV VVGKAGDSWNLGFLAETERQVERHLDSHLRRLPLADQRSRSIVSQMKFDEMSHAQTAVSL GGVDLPGPVRLAMKLSSKVMTGVAYYL