Protein Info for Dsui_1322 in Dechlorosoma suillum PS

Annotation: signal recognition particle protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 TIGR00959: signal recognition particle protein" amino acids 3 to 429 (427 residues), 575.2 bits, see alignment E=4e-177 PF02881: SRP54_N" amino acids 5 to 82 (78 residues), 67.7 bits, see alignment E=2.5e-22 PF06414: Zeta_toxin" amino acids 97 to 188 (92 residues), 27 bits, see alignment E=8.6e-10 PF00448: SRP54" amino acids 100 to 295 (196 residues), 249.1 bits, see alignment E=9e-78 PF01656: CbiA" amino acids 110 to 255 (146 residues), 28.7 bits, see alignment E=3.5e-10 PF02978: SRP_SPB" amino acids 311 to 446 (136 residues), 144.7 bits, see alignment E=5.8e-46

Best Hits

Swiss-Prot: 65% identical to SRP54_ECO57: Signal recognition particle protein (ffh) from Escherichia coli O157:H7

KEGG orthology group: K03106, signal recognition particle subunit SRP54 (inferred from 85% identity to dar:Daro_0642)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QME4 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Dsui_1322 signal recognition particle protein (Dechlorosoma suillum PS)
MLDNLTQRLAGVMKTLRGEARLTESNISDALREVRLALLEADVALPVIKDFIAAVKEKAL
GEEVIGSLTPGQALIGVVHKEMTQLMGGANAALNLATQPPAVILMAGLQGAGKTTTVGKL
AKLLKETQKKKVLVVSCDVYRPAAIEQLKTVAAQACVDFFPSSTEEKPEAIALAAIDWAR
KHYHDVLLVDTAGRLAIDEAMMAEIKQLHAAIKPVETLFVVDAMLGQDAVNTARSFNEAL
PLTGVVLTKLDGDARGGAALSVRHVTGKPVKFVGVGEKLSGLEAFHPERMASRVLGMGDI
LSLVEEARKGVDEEKALAMAKKLKSGKGFDLNDFKDQIAQMRNMGGMAALMDKLPAQFAQ
AAGQLQGGAEDKAVRRIEGIINSMTPAERAKPELIKASRKRRIATGAGVQVQEVNRLLNQ
FEQTQKMMKSFAKGGLSKLMRGMKGMMPGMR