Protein Info for Dsui_1308 in Dechlorosoma suillum PS

Annotation: pyrimidine 5''-nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR01993: pyrimidine 5'-nucleotidase" amino acids 14 to 193 (180 residues), 176 bits, see alignment E=6.6e-56 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 14 to 194 (181 residues), 59.3 bits, see alignment E=5.2e-20 PF13419: HAD_2" amino acids 16 to 194 (179 residues), 57.9 bits, see alignment E=3.1e-19 PF00702: Hydrolase" amino acids 16 to 188 (173 residues), 68.2 bits, see alignment E=2.7e-22 PF13242: Hydrolase_like" amino acids 150 to 201 (52 residues), 22.1 bits, see alignment E=2.3e-08

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 62% identity to dar:Daro_0628)

Predicted SEED Role

"Pyridoxal-5'-phosphate phosphatase (EC 3.1.3.74), Alphaproteobacterial type" (EC 3.1.3.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMD0 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Dsui_1308 pyrimidine 5''-nucleotidase (Dechlorosoma suillum PS)
MAMPRGWRQGGQPVWIFDLDNTLHNASPHIFPHINRAMTAYIQRHLALDEAAAQALRQDY
WHRYGATLLGLMRHHDIDPHHFLRETHDLEVLLPGIVFQRGVKAMLQRLPGRKIVFSNGP
QHYTEAVLEATGIADCFAAAYSVERVRFRPKPESHGFRHLFRAEGLNPHRCIMVEDSLPN
LATAKRLGLKTVWVSTDSAARLRQPAYVDVTLRNILDLPRALRQL