Protein Info for Dsui_1292 in Dechlorosoma suillum PS

Annotation: MSHA-type pilus biogenesis protein MshL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF07660: STN" amino acids 94 to 140 (47 residues), 35.5 bits, see alignment 1e-12 PF07655: Secretin_N_2" amino acids 146 to 246 (101 residues), 72 bits, see alignment E=7.4e-24 TIGR02519: pilus (MSHA type) biogenesis protein MshL" amino acids 242 to 539 (298 residues), 276.5 bits, see alignment E=1e-86 PF00263: Secretin" amino acids 363 to 540 (178 residues), 138.5 bits, see alignment E=2.6e-44

Best Hits

KEGG orthology group: K12282, MSHA biogenesis protein MshL (inferred from 54% identity to dar:Daro_0893)

Predicted SEED Role

"MSHA biogenesis protein MshL" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMB4 at UniProt or InterPro

Protein Sequence (567 amino acids)

>Dsui_1292 MSHA-type pilus biogenesis protein MshL (Dechlorosoma suillum PS)
MKRALIGILASLFLGGCVTSGGKPGATYERIQSEMKGAVDANRSASADAVNQALLPPLQL
DVPKAPPAEPRFDLAVTNAPASQVFMALVSGTRYSMLVPPEVAGSITVNLKNVTLREALE
SLRDLYGYDFRVQGNRITVMSNAMQTRVFQVNYLAGRRQGSSDVRVTSSSISVVSPGASS
SGSSTSSAQAQAATASGTTGAGAGATRAQDSSRVYTSQDADFWTELKTALGAIVGTEDGR
SVIINSHSGVILVRAMPGELRNVEQYLRATQAIIERQVMLEAKIIDVALSDAYQSGINWA
SFSGHTTIGVAANGTSLSPSGALTSDNASIRPGTDGNLGSVGTNGFFGLAFRTKSFAALL
NFLETQGNTQVLSSPRIATLNNQKAVLKVGTDEYYVTNVSSTTIASTTTTTTPTVTLQPF
FSGIALDVTPQINESGLITLHIHPSISVVTEKNKSLSLGTDLAMTLPLATSRINESDTIV
RVRDGEIVAIGGLMTQDQSDTSNGLPGIHQVPVLGNLFGQKSKALNKRELVILLKPTVIQ
NESDWQSDLQNTQSRIDDFDPRRTLPQ