Protein Info for Dsui_1276 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF06347: SH3_4" amino acids 41 to 91 (51 residues), 32.4 bits, see alignment E=9.3e-12 amino acids 102 to 156 (55 residues), 29.9 bits, see alignment E=5.7e-11 PF08239: SH3_3" amino acids 103 to 150 (48 residues), 29.3 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: None (inferred from 56% identity to app:CAP2UW1_1509)

Predicted SEED Role

"FIG00859406: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM98 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Dsui_1276 hypothetical protein (Dechlorosoma suillum PS)
MCQRVSSWMTVLSRALLLCLPALAVQAADYRSVEPGEGSAAAILYDSPSKKGVPQFIIRR
YTPVEVVVNLEGWAKVRDAAGGLAWIERAALADRRTLQVTADRAEVHQAADTASPLAFQA
EKGVALELLEAGPAGWAKVRHRDGQTGYLRANQVWGL