Protein Info for Dsui_1270 in Dechlorosoma suillum PS

Annotation: C-terminal processing peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF22694: CtpB_N-like" amino acids 32 to 89 (58 residues), 42.1 bits, see alignment 2.5e-14 TIGR00225: C-terminal processing peptidase" amino acids 56 to 386 (331 residues), 327.2 bits, see alignment E=5.3e-102 PF00595: PDZ" amino acids 101 to 170 (70 residues), 37.8 bits, see alignment E=5.2e-13 PF13180: PDZ_2" amino acids 103 to 182 (80 residues), 48.9 bits, see alignment E=1.6e-16 PF17820: PDZ_6" amino acids 118 to 172 (55 residues), 40.3 bits, see alignment 5.2e-14 PF03572: Peptidase_S41" amino acids 202 to 381 (180 residues), 187.2 bits, see alignment E=4.3e-59

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 76% identity to app:CAP2UW1_1503)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM92 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Dsui_1270 C-terminal processing peptidase (Dechlorosoma suillum PS)
MKMGKPLKQVGLIGVGMVAGILLSVQISAIADKETRAGLPVEELRTFAEVFNAIKQGYVE
PVEDKKLITNAISGMLSNLDPHSSYLDADSFKELQVGTQGEFGGLGIEVGMEDGFVKVVS
PIEDTPAFRAGLKAGDLIVKLDDTPVKGMTLSDAVKRMRGKPKTPITLTIVRKGEQKPIV
VTLNREVIKVQSVKSKLVEPGYGYVRVTQFQENTGPSLVKHLSDLYKDGALKGLVLDLRN
DPGGLLNGAVGVSAAFLPAKALVVSTDGRTPDAKHQYFASAEDYLRGSRDDYLKNLPAEV
KKVPLVVLVNGGSASASEIVAGALQDHKRAVVLGTQTFGKGSVQTVLPLPGNTAIKLTTA
RYYTPNGRSIQAKGIVPDINVEESANGASPERLREADLERHLINDKEKEAAAAPKSKDGK
ANGKNKGKEEDEKSELPAPAEFASKSDYQLNQALNLLKGLQIMQNKP