Protein Info for Dsui_1265 in Dechlorosoma suillum PS

Annotation: glycine/serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 PF00464: SHMT" amino acids 8 to 383 (376 residues), 546.3 bits, see alignment E=5.1e-168 PF00155: Aminotran_1_2" amino acids 77 to 369 (293 residues), 43.2 bits, see alignment E=4.7e-15 PF00266: Aminotran_5" amino acids 80 to 273 (194 residues), 22.3 bits, see alignment E=9.1e-09

Best Hits

Swiss-Prot: 93% identical to GLYA_DECAR: Serine hydroxymethyltransferase (glyA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 93% identity to dar:Daro_0603)

MetaCyc: 63% identical to serine hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
4.1.2.-; Glycine hydroxymethyltransferase. [EC: 2.1.2.1]; RXN-6321 [EC: 2.1.2.1]; RXN0-5240 [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLS5 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Dsui_1265 glycine/serine hydroxymethyltransferase (Dechlorosoma suillum PS)
MFSANDTLAKVDPELWKAIEDENRRQEEHIELIASENYVSNAVMEAQGSQLTNKYAEGYP
GKRYYGGCEYVDVAEQLAIERLKKLFGAEAANVQPNSGSQANQAVLMAFAKPGDTIMGMS
LAEGGHLTHGMALNMSGKWFNVVSYGLNEKEEIDYDKMEALAREHKPKIIVAGASAYALR
IDFERFAKIAKEVGAIFWVDMAHYAGLIAAGYYPNPVPFADVVTSTTHKTLRGPRGGVIL
MKAEHEKALNSAIFPGLQGGPLMHVIAAKAVAFKEAASPEFKKYQEQVINNARVMAKVLG
EERGLRIVSGRTESHVFLIDLRAKKITGKEAEAALGKAHITVNKNGIPNDPEKPFVTSGI
RIGSPAMTSRGFTEIEAEQIAHLVADVLDAPNDEAKLAEVRAKVAALCAKFPVYGK