Protein Info for Dsui_1263 in Dechlorosoma suillum PS

Annotation: TRAP-type mannitol/chloroaromatic compound transport system, small permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details PF04290: DctQ" amino acids 29 to 161 (133 residues), 86 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: None (inferred from 66% identity to app:CAP2UW1_0554)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLS3 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Dsui_1263 TRAP-type mannitol/chloroaromatic compound transport system, small permease component (Dechlorosoma suillum PS)
MTFLLSVSRGIDALNERVGKAVIWLVLLMTILSAGNAVMRYTINYSSNGLLEIQWYLFAV
IFLFSAGYTLLRNEHVRIDVVAGKFSPRGQAWIDIIGTLLFLMPMAVLIMYLSWPIFMNA
WDSGEMSSNPGGLIRWPARLMIPVGFLLLVLQGLSELIKRIAFLRGLIANPAEKHKGPSA
EEELAAAIKAKKGEA