Protein Info for Dsui_1261 in Dechlorosoma suillum PS

Annotation: response regulator containing a CheY-like receiver domain and a GGDEF domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00072: Response_reg" amino acids 12 to 124 (113 residues), 57.4 bits, see alignment E=7.6e-20 amino acids 148 to 257 (110 residues), 88 bits, see alignment E=2.4e-29

Best Hits

KEGG orthology group: K03413, two-component system, chemotaxis family, response regulator CheY (inferred from 60% identity to dar:Daro_0555)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLS1 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Dsui_1261 response regulator containing a CheY-like receiver domain and a GGDEF domain (Dechlorosoma suillum PS)
MHMISSVADLSVVLVEPSHTQAHIVGQFLRNLGVANMQTAASGADALALLRRSKPSVVIS
AMYLPDMTGTELVYAMRADDDLEMLPFVLISSETRPKVLDPIRQSGACSILPKPFSEKQL
LTALRAVIDYLEPEGQLEVPVDLESLKVLIVDDSPVSRKFLRHILENLGIENFLEASNGK
EAVSVLGETMVDLVLTDYNMPEMDGKALVEYIRQQSWQATVPVLMVTSESNMSRLAAVEQ
AGVSAICDKPFDPKTVKGLIERAMWG