Protein Info for Dsui_1250 in Dechlorosoma suillum PS

Annotation: sulfate permease-like transporter, MFS superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 79 to 110 (32 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 204 to 221 (18 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 351 to 368 (18 residues), see Phobius details amino acids 386 to 416 (31 residues), see Phobius details amino acids 436 to 453 (18 residues), see Phobius details PF00916: Sulfate_transp" amino acids 21 to 379 (359 residues), 304.7 bits, see alignment E=8.4e-95 PF01740: STAS" amino acids 439 to 535 (97 residues), 49.5 bits, see alignment E=3.2e-17

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 69% identity to azo:azo3204)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLR0 at UniProt or InterPro

Protein Sequence (555 amino acids)

>Dsui_1250 sulfate permease-like transporter, MFS superfamily (Dechlorosoma suillum PS)
MSAFRPKLLDCLPDYDRAQFGRDVSAGLTVGVLALPLAMAFAIASGVDPAAGIWTAIVAG
FIIAALGGSRVQIGGPTGAFIVIVYGIVAQYGLANLLIATMLAGLILIGMGLARLGALIR
FIPVTVVIGFTNGIAVLIFISQIKEFLGLDMEALPAEFFAKMKVLAANLPNTDLPTLALA
SASLVLLVLWNKKVAGKLPLLGKLPGPLAVLIAGTVAQSLLEFPVETIGSRFGGIPQSLP
AFAFPELTLSTLRNLISPAITIALLGAIESLLSARVADSQIDDRHDPNQELLAQGVANVV
APLVGGFAATGAIARTSTNVRAGGRTPVAGMVHALTLLAVVLVAAPLASDVPLATLSAIL
MVVAWNMGEWHEFKELPRYSMNYRAILLSTFFITVVFDLTLAVEIGMVLASLFFIYRMSE
LTKVAPLSLPDWAAGQPVAAYSLYGSLFFGAVGKLQTLLDQHAQGTQVLILDLHQVINLD
TTGLDTLEALQRMLAKRGGCLILAGLNAQPGSLVSRSGFADDVGTDNLVASLAEAWQRAA
ILLPRDEAAGSPSHA