Protein Info for Dsui_1234 in Dechlorosoma suillum PS

Annotation: putative Zn-dependent protease-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 PF01523: PmbA_TldD_1st" amino acids 47 to 111 (65 residues), 61.9 bits, see alignment E=8e-21 PF19290: PmbA_TldD_2nd" amino acids 139 to 248 (110 residues), 68.1 bits, see alignment E=1.3e-22 PF19289: PmbA_TldD_3rd" amino acids 256 to 463 (208 residues), 241.2 bits, see alignment E=1.1e-75

Best Hits

Swiss-Prot: 46% identical to PMBA_HAEIN: Metalloprotease PmbA homolog (pmbA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03592, PmbA protein (inferred from 69% identity to app:CAP2UW1_0557)

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLP4 at UniProt or InterPro

Protein Sequence (464 amino acids)

>Dsui_1234 putative Zn-dependent protease-like protein (Dechlorosoma suillum PS)
MAKKALPKPSRTTAAATSGRFSLPQADLLQLARDTVALATRGGASAAEVDVSEGFGQSVS
VRQGEVETIEYNRDKGIGVTVYLGQRKGYASTSDFSRQALAQTVDAALAIARYTAEDPCA
GLPEKALLAKQWQDPQLYYPWQLSVEGAIDLARRCEDAAFAVSPLVKNSEGATVSLQEGQ
FATANSLGFAGGYPSSRHYIACSVIAGKKGRNAEMQRDDWYSTHRDPADFPAPESIGDYA
ARRALSRLGGRKVKTCEVPVIFEAPIASGLLGNFVYAASGGSLYRKASFLVDSLGKRIFA
PGINISERPDLPKGLASGPFDNDGVATRSRQVVSDGVLNGYFLSVYTARKLGMTTTGNAG
GCHNLVLEPGREDLAGLIRQVKRGLLVTELLGQGVNYVNGDYSRGAAGYWIENGEIAYPV
EEITIAGNLKEMFMNIAGVGNDVVVRGSKQTGSILIQRMTVAGA