Protein Info for Dsui_1232 in Dechlorosoma suillum PS

Annotation: TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 2 to 23 (22 residues), 20.8 bits, see alignment (E = 1.8e-08) PF03480: DctP" amino acids 42 to 321 (280 residues), 227.3 bits, see alignment E=1.3e-71

Best Hits

Swiss-Prot: 56% identical to TAKP_RHOS4: Alpha-keto acid-binding periplasmic protein TakP (takP) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 86% identity to dar:Daro_0598)

Predicted SEED Role

"TRAP transporter solute receptor, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLP2 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Dsui_1232 TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component (Dechlorosoma suillum PS)
MDRRKFLKNAGVAAGAGVATTVAAPAIAQSQPTIKWRLTSSFPKSLDTIYGGADVLANRL
RAMTGGKFDIRVFAGGEIVPGLQALDAVQQGTVEMCHTCSYYYVGKDKTFGFGTSVPFGM
NPRQMNAWIYYGGGQKLLDEFYANYNVVSFAGGNTGTQMGGWFRKEIKTLDDVKGLKMRI
AGLGGAVFERLGAVPQQIAGSDIYPALEKGTIDAAEWVGPYDDEKLGFFKVAKNYYYPGW
WEPGPTIHFFVNKKEWDKLPKEYQEAFQAAAYEANVTMLAEYDHKNPTALSRLLSQGVKL
QKYPDAVLEAAYKAAMDLYTEESAKNPAFKKVWTEYDKYRRTQNAWFSVADTTMDRFLQS
HK