Protein Info for Dsui_1222 in Dechlorosoma suillum PS

Annotation: DNA polymerase III, delta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR01128: DNA polymerase III, delta subunit" amino acids 18 to 332 (315 residues), 285.7 bits, see alignment E=2.4e-89 PF06144: DNA_pol3_delta" amino acids 21 to 189 (169 residues), 77.3 bits, see alignment E=1.2e-25 PF14840: DNA_pol3_delt_C" amino acids 219 to 330 (112 residues), 39.1 bits, see alignment E=9e-14

Best Hits

KEGG orthology group: K02340, DNA polymerase III subunit delta [EC: 2.7.7.7] (inferred from 69% identity to dar:Daro_0542)

Predicted SEED Role

"DNA polymerase III delta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLN2 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Dsui_1222 DNA polymerase III, delta subunit (Dechlorosoma suillum PS)
MAQLRGEQLAAHLERPLGPLYVVYGDEPLLVIEAGDAIRAAARRQGYSEREVLVAGQGFN
WTQLAMAGGNLSLFGDRKLIDLRIPTGKPGRDGGQALQEHCQRLSSDAMTLVTLPELTWQ
DEKASWFQTLAEAGTVLKLQAPNLGELPQWIAGRLQRQEQSAETEALRFIAERVEGNLLA
AHQEIQKLGLLFPKGKLSLEQVREAVLNVARYDIDGLREALLQGDLARLTRTLDGLRQEG
EAPPLVLWAVTEEVRALAALKEGLNAGRPADQLLKEQRIWGPRQALVKRALGRLDAPRLR
AALAQTAHIDRCIKGLGGGDVWDEFLRLGLSLR