Protein Info for Dsui_1220 in Dechlorosoma suillum PS

Annotation: gamma-glutamyl phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 12 to 280 (269 residues), 51.8 bits, E=2.5e-18
  • amino acids 310 to 375 (66 residues), 32 bits, E=2.5e-12
• TIGR00407: glutamate-5-semialdehyde dehydrogenase
  • amino acids 14 to 407 (394 residues), 485.7 bits, E=4.8e-150

Best Hits

Swiss-Prot: 81% identical to PROA_DECAR: Gamma-glutamyl phosphate reductase (proA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 81% identity to dar:Daro_0540)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-ornithine biosynthesis II (2/3 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-N^δ-acetylornithine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

See G8QLN0 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Dsui_1220 gamma-glutamyl phosphate reductase (Dechlorosoma suillum PS)
MDIKDYMQNLGRRARAASRQMAKADTNAKNRALLAIAAAIRRDEAKLLAANGEDLAAARA
AGLEPAMVDRLTLSPKTVATMAEGLEQIASLPDPIGEMTDLRFRPSGIQVGHMRVPLGVI
GIIYEARPNVTVDAAGLCIKSGNASILRGGSEAIRCNQALATLVKEGLQSAGLPADAVQV
VETTDRAAVGELITMREFVDVIVPRGGKGLIARLLAESRVPMIQHLDGNCHVYLDDSADA
AKAMAVVENSKTQRYGTCNTAESLLVARSVAATLLPPIAAMLTAKGVEIRGCAETRALVP
NAKEATEADWGEEYLAPIIAVKVVAGLDEAIEHINKYSSSHTEAIVTENHTHAMRFLREV
DSASVMVNASTRFADGFEYGLGAEIGISTDKIHARGPVGLEGLTSQKWVVLGNGQVRG