Protein Info for Dsui_1198 in Dechlorosoma suillum PS
Annotation: apolipoprotein N-acyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to LNT_RALSO: Apolipoprotein N-acyltransferase (lnt) from Ralstonia solanacearum (strain GMI1000)
KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 49% identity to nmu:Nmul_A0552)Predicted SEED Role
"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Benzoate degradation via CoA ligation
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Glycerophospholipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-
Use Curated BLAST to search for 2.3.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QLK9 at UniProt or InterPro
Protein Sequence (505 amino acids)
>Dsui_1198 apolipoprotein N-acyltransferase (Dechlorosoma suillum PS) MGIAAFLSPLRSDGRARLLAAGAGLLGVGAFAPFAVFWLAWLSWGALFLLVSRAPSPRAA AWRGFAFGLAQFLGGVSWVYVSLHDVGGMPLPVAALATLALCAYMALYPMAAAWSARRLD FSDKASWRSACLFAASWVLAEWARGWVLTGFPWLALGYSQSPPSPLAGLAPLLGVYGVSL ASALLGAWGALAVVGRQRLPGLLVLLLLGLGAGLGLVQWTVPAGEPLRVALLQGNIPQDL KWQPERFLDSLTTYVGLARDNPADLTVLPETAVPALYDQLPPEFIADLKALAARRGGDLL LGVPVADESSGERRYYNSAIGFGASPQQSYSKAHLVPFGEFVPPGFRWFLDLMHMPMSDF SSGGARQPTLALAGQQIAPNICYEDVFGGEIIHALPRATLLVNLSNTAWFGRSLAQPQHL QIAQLRALETGRPMLRATNTGMTAVVAPDGRVQAVLPPFTRGALVAEVRGYQGLTPFART GNTVALFLATLLLAAGALARRRETQ