Protein Info for Dsui_1191 in Dechlorosoma suillum PS

Annotation: type IV pilus secretin PilQ/competence protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 724 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF11741: AMIN" amino acids 44 to 126 (83 residues), 33.7 bits, see alignment E=6.4e-12 amino acids 158 to 257 (100 residues), 81.3 bits, see alignment E=9.9e-27 TIGR02515: type IV pilus secretin PilQ" amino acids 274 to 718 (445 residues), 469.7 bits, see alignment E=5e-145 PF07660: STN" amino acids 299 to 347 (49 residues), 30.8 bits, see alignment 4.2e-11 PF03958: Secretin_N" amino acids 372 to 437 (66 residues), 46.8 bits, see alignment E=5.6e-16 PF00263: Secretin" amino acids 562 to 717 (156 residues), 163.4 bits, see alignment E=7.6e-52

Best Hits

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKY8 at UniProt or InterPro

Protein Sequence (724 amino acids)

>Dsui_1191 type IV pilus secretin PilQ/competence protein (Dechlorosoma suillum PS)
MKFYKQILKVASLLGLLSFSAYGVAQSNAIEAINVATQGDSVTLKVSLKNPLAAIPASFS
VASPARVALDFPDTENSLGKNAEQLSSGGIRGYNVVQSDKRTRLVLNLNQPMAYETRLEG
NQVYVTLTKVTGAIVADNKVSQFAESKYAATTHAIRSINFRRGAGGEGRVVIDLSDANVG
VDVRQQGEQVIVEFQKATLPPHMAQKIDVTDFSTPVTSVTAMPQAGNARVAISAKGLWEH
QAYQAENQFVIEVKAVSEDPNKLARSGGPHEYGGDKISLNIQNTPVKQLLQTLGEEFGYN
VVMSDTVSGSISLRLQNVPWDQAFDLILERGGLDKRRRGTVLLIAPKDELLKKEELELQA
KQQISDVEPLKTETFQLNYQRAEAFHKVLTDEKQRILSKRGSAVMDPRTNTLFIQDTPTR
LEELRKIIAKTDVPVRQVLIEARIVEATDNFSKNLGVRLGFNDISNPVNGTGRLQSRIGG
SMLDQARETYQNVISRTIDATTGIETITRPAKVMLDNSATYNNSATSVNLPASAIKGSQA
GAFSLVLFNPSATRFLNLELSALEVDGKGKVVSSPRVMTSDQAEAIIEQGIEIPYQQATS
SGATAVMFKKANLSLKVKPQITPDGRVIMSLDINKDVPDTTIASNVIAIKTKHIKTDILV
ENGGTVVIGGIYEETENQATSRIPFLGDLPYVGFLFRNTRTDRDKVELLIFITPKIVSGD
LALR