Protein Info for Dsui_1187 in Dechlorosoma suillum PS

Annotation: type IV pilus assembly protein PilM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR01175: type IV pilus assembly protein PilM" amino acids 14 to 357 (344 residues), 346.8 bits, see alignment E=6.1e-108 PF11104: PilM_2" amino acids 17 to 357 (341 residues), 504.9 bits, see alignment E=1e-155 PF14450: FtsA" amino acids 200 to 325 (126 residues), 43.3 bits, see alignment E=4.5e-15

Best Hits

KEGG orthology group: K02662, type IV pilus assembly protein PilM (inferred from 78% identity to dar:Daro_0210)

Predicted SEED Role

"Type IV pilus biogenesis protein PilM" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKY4 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Dsui_1187 type IV pilus assembly protein PilM (Dechlorosoma suillum PS)
MQLDLSIFNPKAKPLIGLDISSSAVKMVELSGNAKDGFRVERYTIEVLSRDVIADGNIVN
LEAAAESVKRAWKRMGTSTRQVAMALPAAAVITKKIIVPAGQREEELEVLVESEANQYIP
FALEEVNLDFQVIGPAPSSPDEVEVLIAASRKEKVEDRVAVAEAAGLKAAVMDVESYAAL
AAFELIERQLPDQGKNQVVAIVDIGANVTNLTVMRNGQQVYAREQAFGGAQLTQDIVRQY
GMSFEEADAAKRNGGLPENYEAELLRPFMESLALEVSRALQFFFTSTQYNQVNHLVLAGG
CAAIPGLDEVVATRTQVNCLVANPFAGMSVSDRVRPRNLVNDASSLMVACGLALRRFEE