Protein Info for Dsui_1178 in Dechlorosoma suillum PS

Annotation: ferredoxin-type protein NapF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR00402: ferredoxin-type protein NapF" amino acids 23 to 160 (138 residues), 121.9 bits, see alignment E=1.1e-39 PF13237: Fer4_10" amino acids 37 to 82 (46 residues), 31.7 bits, see alignment E=7.7e-11 PF12838: Fer4_7" amino acids 38 to 82 (45 residues), 36.1 bits, see alignment E=4.8e-12 amino acids 113 to 159 (47 residues), 33.8 bits, see alignment E=2.4e-11 PF13187: Fer4_9" amino acids 38 to 84 (47 residues), 32.1 bits, see alignment E=6.4e-11 PF12837: Fer4_6" amino acids 38 to 53 (16 residues), 24.3 bits, see alignment (E = 1.5e-08) PF12798: Fer4_3" amino acids 39 to 53 (15 residues), 19.3 bits, see alignment (E = 1.1e-06) PF00037: Fer4" amino acids 39 to 55 (17 residues), 24.3 bits, see alignment (E = 1.4e-08) amino acids 141 to 161 (21 residues), 27.5 bits, see alignment (E = 1.3e-09) PF12800: Fer4_4" amino acids 39 to 52 (14 residues), 14.6 bits, see alignment (E = 2.3e-05) amino acids 143 to 157 (15 residues), 14.1 bits, see alignment (E = 3.4e-05)

Best Hits

Swiss-Prot: 45% identical to NAPF_ECOL6: Ferredoxin-type protein NapF (napF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02572, ferredoxin-type protein NapF (inferred from 58% identity to dar:Daro_4000)

Predicted SEED Role

"Ferredoxin-type protein NapF (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKX5 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Dsui_1178 ferredoxin-type protein NapF (Dechlorosoma suillum PS)
MSHPPANLSRRGFFRGRSAPAAPLRPPWAVDEAAFLQQCTGCGDCIRVCPTGILTALAPG
QPPVVDFRQGECTFCGQCASACRPRALRREDDRQPWPYKATAGEACLARQQVECRSCGDF
CPEGALRFPARAGGPALPVLLEDRCTGCGACLAPCPTAAISIGRPD