Protein Info for Dsui_1170 in Dechlorosoma suillum PS

Annotation: heme exporter protein CcmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 64 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details TIGR03141: heme exporter protein CcmD" amino acids 10 to 55 (46 residues), 57.6 bits, see alignment E=5.2e-20 PF04995: CcmD" amino acids 13 to 55 (43 residues), 51.8 bits, see alignment E=3.5e-18

Best Hits

KEGG orthology group: K02196, heme exporter protein D (inferred from 67% identity to dar:Daro_3994)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmD, interacts with CcmCE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKW7 at UniProt or InterPro

Protein Sequence (64 amino acids)

>Dsui_1170 heme exporter protein CcmD (Dechlorosoma suillum PS)
MHWNSASEFFAMGGYAFYVWGSFGVTALIMAVEPIIVARRRKNLLSRLKRQITAENLAQR
SEES