Protein Info for Dsui_1168 in Dechlorosoma suillum PS

Annotation: heme exporter protein CcmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 128 to 154 (27 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details PF03379: CcmB" amino acids 6 to 219 (214 residues), 257.7 bits, see alignment E=3.7e-81 TIGR01190: heme exporter protein CcmB" amino acids 8 to 218 (211 residues), 255 bits, see alignment E=2.7e-80

Best Hits

Swiss-Prot: 51% identical to CCMB_SHIFL: Heme exporter protein B (ccmB) from Shigella flexneri

KEGG orthology group: K02194, heme exporter protein B (inferred from 78% identity to app:CAP2UW1_0727)

MetaCyc: 50% identical to cytochrome c maturation protein B (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKW5 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Dsui_1168 heme exporter protein CcmB (Dechlorosoma suillum PS)
MLDLLFAVIARDLKLALRRQADLVSALFFFIIVVSLFPLGVGPEMDMLRKMAPGVLWVAA
LLATMLTLPRLFGDDYRDGTLEQLVLAPQPLPVTVLGKMAAHWLTSGLPLTLLAPVLGLQ
FDLSADGLLVLTLALLVGTPSLSAIGAIGAALTLGLRGGGVLVSLLVLPLYIPVLIFGAG
AVDAAVSGLGFEAHLSLLGALLAGSLFFAPWATAAALKISLE