Protein Info for Dsui_1168 in Dechlorosoma suillum PS
Annotation: heme exporter protein CcmB
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to CCMB_SHIFL: Heme exporter protein B (ccmB) from Shigella flexneri
KEGG orthology group: K02194, heme exporter protein B (inferred from 78% identity to app:CAP2UW1_0727)MetaCyc: 50% identical to cytochrome c maturation protein B (Escherichia coli K-12 substr. MG1655)
RXN-21408
Predicted SEED Role
"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes
MetaCyc Pathways
- cytochrome c biogenesis (system I type) (3/11 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QKW5 at UniProt or InterPro
Protein Sequence (222 amino acids)
>Dsui_1168 heme exporter protein CcmB (Dechlorosoma suillum PS) MLDLLFAVIARDLKLALRRQADLVSALFFFIIVVSLFPLGVGPEMDMLRKMAPGVLWVAA LLATMLTLPRLFGDDYRDGTLEQLVLAPQPLPVTVLGKMAAHWLTSGLPLTLLAPVLGLQ FDLSADGLLVLTLALLVGTPSLSAIGAIGAALTLGLRGGGVLVSLLVLPLYIPVLIFGAG AVDAAVSGLGFEAHLSLLGALLAGSLFFAPWATAAALKISLE