Protein Info for Dsui_1167 in Dechlorosoma suillum PS

Annotation: heme ABC exporter, ATP-binding protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 2 to 195 (194 residues), 218 bits, see alignment E=4.8e-69 PF00005: ABC_tran" amino acids 19 to 158 (140 residues), 99.8 bits, see alignment E=2.1e-32

Best Hits

Swiss-Prot: 74% identical to CCMA_DECAR: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 75% identity to app:CAP2UW1_0728)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKW4 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Dsui_1167 heme ABC exporter, ATP-binding protein CcmA (Dechlorosoma suillum PS)
MLEASQLECVRGDRRLFAGVSFRLEGGELLNLQGKNGAGKTSLLRMLVGLAQPVAGEITW
RGEPIRKLAEDYRAELCYMGHHNAIKEELTPLENLLASARLSGEPLSEEQALEALYAVGL
AGREDLQAKYLSQGQKRRVALARLIHERRALWVLDEPFVALDVAAVDMVAGLIGAHLQRG
GLAVMTTHQAVTIPAGAVREYRLGA