Protein Info for Dsui_1164 in Dechlorosoma suillum PS

Annotation: hydrogenase nickel insertion protein HypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 TIGR00100: hydrogenase nickel insertion protein HypA" amino acids 1 to 114 (114 residues), 102.8 bits, see alignment E=6e-34 PF01155: HypA" amino acids 1 to 113 (113 residues), 121.5 bits, see alignment E=9.2e-40

Best Hits

Swiss-Prot: 64% identical to HYPA_RHOFT: Hydrogenase maturation factor HypA (hypA) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 69% identity to app:CAP2UW1_0730)

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKW1 at UniProt or InterPro

Protein Sequence (114 amino acids)

>Dsui_1164 hydrogenase nickel insertion protein HypA (Dechlorosoma suillum PS)
MHEMSLAEGVLQIVEDAAQGPQGFARVKTVFLEIGQLSSVEPEAMAFCFEAVSKGTVADG
AKLEIVSVPGEGLCLSCQKTVPLAQVYDPCPECGGYPVQPTAGTEMRVRELEVD