Protein Info for Dsui_1162 in Dechlorosoma suillum PS

Annotation: (NiFe) hydrogenase maturation protein HypF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 779 PF00708: Acylphosphatase" amino acids 12 to 94 (83 residues), 80.7 bits, see alignment E=1.9e-26 TIGR00143: carbamoyltransferase HypF" amino acids 13 to 772 (760 residues), 736.4 bits, see alignment E=1.7e-225 PF07503: zf-HYPF" amino acids 113 to 145 (33 residues), 51.5 bits, see alignment (E = 1.8e-17) amino acids 164 to 195 (32 residues), 52.1 bits, see alignment (E = 1.1e-17) PF01300: Sua5_yciO_yrdC" amino acids 214 to 403 (190 residues), 131.9 bits, see alignment E=4.7e-42 PF17788: HypF_C" amino acids 417 to 516 (100 residues), 111 bits, see alignment E=1e-35 PF22521: HypF_C_2" amino acids 525 to 769 (245 residues), 238.5 bits, see alignment E=2.4e-74

Best Hits

Swiss-Prot: 61% identical to HYPF2_CUPNH: Carbamoyltransferase HypF2 (hypF2) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K04656, hydrogenase maturation protein HypF (inferred from 60% identity to app:CAP2UW1_0732)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypF" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKV9 at UniProt or InterPro

Protein Sequence (779 amino acids)

>Dsui_1162 (NiFe) hydrogenase maturation protein HypF (Dechlorosoma suillum PS)
MNDLTLPLLCRRVRVRGLVQGVGYRPFVYRLAFELGLGGWVRNDAEGVDIEARGPAPLVE
RFIARLRAEAPELARVEAVEVREAEPERSLPGFLIVESRGGHASTSIGPDSALCHDCLEE
LFAPQDRRHRYAFTHCTHCGPRYSITRELPYDRARTSLAPFPQCPACTAEYADPHNRRFH
AEANCCPDCGPRLRLLDAAGQPIAGDPVRKAVGLLQAGKIVALKGYGGFHLACDARNGAA
VAELRKRKHREEKPFAVMAANVASANALCALGGDEAGLLELPERSIVLLRKQDNTDTQLP
GVAPGLQWLGLMLPYAPLHYLLFHAAAGEPAGLAWLAQAQDLVLVMTSANPGGEPLVTDN
AEAVGRLAGMADAFLCHDRDIVIRSDDSVIRCDEGGVQFLRRGRGQTPRPIKLKDEGPAV
LAFGPYLKNTLCVVKGREAYLSQHIGDLDNVPTVNFLEETAAHLLHILDVEPQVIAHDLH
PDFPSTRLAAAFAAERGIPAIAVAHHHAHIAAVLAETRYPKPVIGLALDGIGLGEDGGLW
GGELLRVDGADCQRLGGLLSLQLPGGDRAAREPWRLAAAALHALGRNGDIEAFVAHRYPD
QQGAAMIAEMLRKQLNCPPTSSLGRLFDAAAGLLGLRASQRFEAQAAMELEGRAHAWEER
HGPAASLTDGWNINNDGHLDLLPLLAWLGECDDADLGAARFHATLAAGLVHWAAAAAERA
NLSTVALGGGCLLNHLLSRDLRMGLQARGLAVLEARQAPPNDGGIALGQAWVARQSLGR