Protein Info for Dsui_1159 in Dechlorosoma suillum PS

Annotation: hydrogenase expression/formation protein HypD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR00075: hydrogenase expression/formation protein HypD" amino acids 2 to 371 (370 residues), 484.5 bits, see alignment E=9.5e-150 PF01924: HypD" amino acids 12 to 369 (358 residues), 514.5 bits, see alignment E=7.4e-159

Best Hits

Swiss-Prot: 75% identical to HYPD_CUPNH: Hydrogenase maturation factor HypD (hypD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K04654, hydrogenase expression/formation protein HypD (inferred from 85% identity to dar:Daro_3966)

MetaCyc: 48% identical to Fe-(CN)2CO cofactor assembly scaffold protein HypD (Escherichia coli K-12 substr. MG1655)
RXN-22646; RXN-22647

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypD" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKV6 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Dsui_1159 hydrogenase expression/formation protein HypD (Dechlorosoma suillum PS)
MKYVDEYRDGELAQGLAAAIAKEARPERRYHFMEFCGGHTHAISRYGVTDLLPANVRMIH
GPGCPVCVLPIGRVDQAIRLALKHNVILCTYGDCLRVPASDGLSMLKAKARGADIRMVYS
SADALKLAQENPEKQVVFFAIGFETTTPPTAVAIKQAKVMGLKNFSVLCCHVLTPSAISN
ILESPEVRKLGTVPLDGFIGPAHVSTIIGSRPYEFFAEEYRKPVVIAGFEPLDVMQAIRM
LVRQVNEGRAEVENEFSRAVSREGNLKAQNLVAEVFELRRAFEWRGLHTVPYSALRIRGG
FAEFDAEQRFGEDYVSVPDHKACECGAILRGAKRPQDCKLFGTVCTPENPVGSCMVSSEG
ACAAHYTYGRFRELPA