Protein Info for Dsui_1154 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF00072: Response_reg" amino acids 10 to 125 (116 residues), 71.1 bits, see alignment E=3.1e-23 PF00158: Sigma54_activat" amino acids 180 to 340 (161 residues), 228.8 bits, see alignment E=1.2e-71 PF14532: Sigma54_activ_2" amino acids 182 to 345 (164 residues), 66.2 bits, see alignment E=1.4e-21 PF00004: AAA" amino acids 198 to 332 (135 residues), 25 bits, see alignment E=8.1e-09 PF07728: AAA_5" amino acids 198 to 316 (119 residues), 33.4 bits, see alignment E=1.5e-11 PF25601: AAA_lid_14" amino acids 346 to 422 (77 residues), 73.5 bits, see alignment E=3.6e-24 PF02954: HTH_8" amino acids 446 to 486 (41 residues), 42.7 bits, see alignment 1.3e-14

Best Hits

Swiss-Prot: 59% identical to HOXA_CUPNH: Hydrogenase transcriptional regulatory protein HoxA (hoxA) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 74% identity to dar:Daro_3962)

Predicted SEED Role

"Hydrogenase transcriptional regulatory protein HoxA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKV1 at UniProt or InterPro

Protein Sequence (491 amino acids)

>Dsui_1154 response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Dechlorosoma suillum PS)
MKNVPALPAVLVVDDEVRSQEALRRTLEEDFTVFTASGADEAMAIMEREQGASGGKGVQV
VLCDQRMPGTSGVAFLTEVRQRWPDVVRIVLSGYTEAGDIIAGINEAGIYQYLLKPWQPE
QLLLTLKSAANVWRLQQDNQRLSLELRAAEPVLASKVEMKYERVKRELGLDGLTRSAGSP
MNPVCDMVQRIAPYDLSVLLMGESGTGKEMLARAIHYQSRRDRQAFVVENCGALPDQLLE
AELFGYKRGAFTGAYEDRIGLFQQADGGTIFLDEIGETSPAFQVKLLRVLQEGEFRPLGS
PRPVSVNVRVIAATNRDLEAEVREGRFREDLYYRLATVTLHVPPLRERPMDIPLLAQRLL
EASQKALGKTVQGFTTETLACIAAYRWPGNVRELQNEILRMLALCEGKQLGAELLSPRVL
RAPVGVHEDAELSFLADLSGGLKERMEQLEAKVVKEALIRHRWNKSKAAADLGLSRVGLR
NKLVRYGLEKG