Protein Info for Dsui_1131 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 21 to 23 (3 residues), see Phobius details amino acids 43 to 43 (1 residues), see Phobius details transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 64 to 90 (27 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 173 (18 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details PF13795: HupE_UreJ_2" amino acids 49 to 246 (198 residues), 228 bits, see alignment E=3.5e-72

Best Hits

KEGG orthology group: None (inferred from 83% identity to pau:PA14_31000)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKS8 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Dsui_1131 hypothetical protein (Dechlorosoma suillum PS)
MTPSPILFNKEFPLPFRQFSATGICRWTVALLASLLPLWAFAHGVTGEDQSFLEQNTGRN
LLLFAYLGAKHMVTGYDHLLFLFGVVFFLYRMRDVSIYVTLFAVGHSVTLLLGVLGGFHV
NPYVVDAIIGVSVVYKALDNLGAFKHWLGFQPNTKAAVLVFGFFHGFGLATKLQDFSLSR
DGLVPNMLAFNVGVELGQLLALAGILIVMGFWRRSTAFSRQAFTANTALMAAGFVLVGYQ
LTGYFVS