Protein Info for Dsui_1126 in Dechlorosoma suillum PS

Annotation: outer membrane receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 PF07715: Plug" amino acids 2 to 103 (102 residues), 58.2 bits, see alignment E=1.1e-19 PF00593: TonB_dep_Rec" amino acids 175 to 589 (415 residues), 99.9 bits, see alignment E=3.2e-32

Best Hits

KEGG orthology group: None (inferred from 58% identity to dar:Daro_3944)

Predicted SEED Role

"Nicel/Cobalt-specific TonB-dependent outer membrane receptor" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK95 at UniProt or InterPro

Protein Sequence (633 amino acids)

>Dsui_1126 outer membrane receptor protein (Dechlorosoma suillum PS)
MTAKQLENRPLLRPAEVLETVPGLIVTQHAGDGKANQYFLRGFNLDHGTDFSVAIDGMPI
NLPTHAHGHGYLDLNFLIPELVERIQYKKGPYAAEDGDFSSAGSARIDYRRALPEDYVSI
GLGSNGYRRLLTAADKETAGGGRWLGAVEVFHNDGPWEVPEHYKRLNGVLRYSEGTRNNG
HSVAFMAYDGDWTSTDQLARRAVDQGLVNRYGSLDPTAGGNTRRLSLSGQWARQDGAVQT
RANAYLVDYRLNLFSNFTYAMDDPVNGDQFEQADRRRYGGFGWSRSQPVQWLGKEGDFTW
GVQGRQDDIDNVGLYRTAARQRLSTVRSDSVNQGSLGLYGQWGAQWSDWLRSVAGLRHDR
YRFKVDSSLAANSGKENDGITSPKLSLIFGPFANQEFYYNWGQGFHSNDARGTTIRVDPS
NPGDPMSRVPALVKSRGQEVGWRSAPAPGWNTSVALWRLDLDSELLFVGDAGTTEAGRPS
HRQGVEWSNYWTPRDWLTLDADIALSKARFRDDDAAGKYIPGAVERTASVGVAVHDLGPW
RGGLRLRYLGPRALIEDNSVRSGSSVMVNLNVGYKLAAKSQLTLEVLNLFNRKASDIDYY
YESRLRGEAATVADVHSHPAEPRIWRLTYTQGF