Protein Info for Dsui_1121 in Dechlorosoma suillum PS

Annotation: alternative sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR02392: alternative sigma factor RpoH" amino acids 16 to 284 (269 residues), 409.5 bits, see alignment E=7.4e-127 PF00140: Sigma70_r1_2" amino acids 18 to 48 (31 residues), 26.8 bits, see alignment 6.3e-10 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 50 to 280 (231 residues), 109.6 bits, see alignment E=1.3e-35 PF04542: Sigma70_r2" amino acids 55 to 124 (70 residues), 72.6 bits, see alignment E=2.7e-24 PF04545: Sigma70_r4" amino acids 229 to 280 (52 residues), 56.2 bits, see alignment 2.9e-19

Best Hits

Swiss-Prot: 57% identical to RPOH_SERMA: RNA polymerase sigma factor RpoH (rpoH) from Serratia marcescens

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 73% identity to app:CAP2UW1_4157)

MetaCyc: 56% identical to RNA polymerase sigma factor RpoH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK90 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Dsui_1121 alternative sigma factor RpoH (Dechlorosoma suillum PS)
MTQALTLSHGLPSAVGNLDAYIQAARRFPMLSEAEEFALARRLREEDDVDAARQLVLSHL
RLVIAIARGYLGYGLPHADLIQEGNIGLMKAVKRFDPSRGVRLVSFAMHWIKAEIHEYIL
KNWRLVKVATTKAQRKLFFNLRSLKASSDTLTPAEVDEIAYKLGVKAEEVVEMETRMGGR
DLALDGSPDDEDDNRVAPIAYLADSAAEPTQVLEAREYDRLQSDGLQQALAGLDERSRRI
VEARWLDEENPATLHDLAAEFGVSAERIRQIEVKALQKMKGLLAA