Protein Info for Dsui_1118 in Dechlorosoma suillum PS

Annotation: putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 52 (17 residues), see Phobius details amino acids 58 to 82 (25 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details PF03547: Mem_trans" amino acids 152 to 293 (142 residues), 55.8 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 74% identity to dar:Daro_0262)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK87 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Dsui_1118 putative permease (Dechlorosoma suillum PS)
MTTALLLLPDFCLILLGLLLRRYMHLGDHFWAGIEKLVYFILFPALLVNAVLKTRLDLAA
AAPLLATALLSMGAGMVLSWAGLKCFRLKPLVLASLFQCGYRFNSYIALAAAGLLFGTPG
IATMGLIIGAAVPLANLSAVWMLARHGEAGALREVARNPLIWATASGFLLNLTGFVPPAP
LQMFLSRLGDASIALGLLAVGAALRLRGQAEVRSASFYILGVKLLLLPLVAIFAGPLLGL
SGLYYHVAILFAALPTASSAYILAMRMGGDGQSVAWLISASTLASMLTMPLWMSRFLG