Protein Info for Dsui_1116 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 183 to 204 (22 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 1 to 174 (174 residues), 90.4 bits, see alignment E=2.2e-29 PF02203: TarH" amino acids 1 to 127 (127 residues), 43.2 bits, see alignment E=8.1e-15 PF00672: HAMP" amino acids 210 to 255 (46 residues), 28.1 bits, see alignment 4e-10 PF00015: MCPsignal" amino acids 346 to 501 (156 residues), 154.7 bits, see alignment E=4.4e-49

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 50% identity to azo:azo0129)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK85 at UniProt or InterPro

Protein Sequence (535 amino acids)

>Dsui_1116 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MTIAKRLALLILLAVAGLIVVGGFGLKEMGAINANLEYAHENSIPSIRKVASMESNFLRL
RTQMLVFLLSTEEQRPAVEQRIEGAKKDLLQALQDYEKLISDDKDRQYLETSKALVKEYY
ALIDPAIADTKAGHGEKAKNGMGQAGEVSKRLAENVEAHSKYNEHLAEEEVRKAGEAYQT
GKVISIVVILLCTAGVAGLGFMVYRHVDSSLGNMVSMFSRIEKELDFTGRLEVRGTDEVA
QASSAFNRLLDRLQASFREISNHTDAVNNAANRVATASHQMSIASGHQSEAASSMAATVE
EMTVSITHVADRAGEANQLSSASGALAHKGEGIIGDTVQGINGIAETVRNASEQIARLEQ
QSERINNVVAVIKEVADQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERTTQSTQE
IASTILEMQAGAQAAVHGIHAVVEKVDEGVSRAEQANEAIQEIGEGSRKTVDMVGDISDA
IREQSMASTAIAQQVEKIAQMSEENSAAAQSTSDTAGELAHLAQEMQQVVAQYRL