Protein Info for Dsui_1094 in Dechlorosoma suillum PS

Annotation: shikimate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF13238: AAA_18" amino acids 8 to 119 (112 residues), 36.3 bits, see alignment E=7.4e-13 PF01202: SKI" amino acids 14 to 168 (155 residues), 179.5 bits, see alignment E=5.6e-57

Best Hits

Swiss-Prot: 63% identical to AROK_THIDA: Shikimate kinase (aroK) from Thiobacillus denitrificans (strain ATCC 25259)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 63% identity to tbd:Tbd_0207)

MetaCyc: 47% identical to shikimate kinase 1 (Escherichia coli K-12 substr. MG1655)
Shikimate kinase. [EC: 2.7.1.71]

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK63 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Dsui_1094 shikimate kinase (Dechlorosoma suillum PS)
MKTKQDNIILVGLMGAGKTTIGRLLAKRLGKRFVDSDHEVESRTGVSIPVIFEIEGEAGF
RKRESMVIEDLSRESGLVMATGGGVVLSPENREAIKAGGFVVYLCAPPELLYARTRNDRN
RPLLQVADPLGRLRQLYVQRDPLYREVADMVIDASSHSANASVQLLLRVTQSAPLVGVEP
APAPPTPSTP