Protein Info for Dsui_1079 in Dechlorosoma suillum PS

Annotation: putative protein-S-isoprenylcysteine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 146 to 172 (27 residues), see Phobius details PF04140: ICMT" amino acids 117 to 184 (68 residues), 26.3 bits, see alignment E=8.1e-10 PF04191: PEMT" amino acids 127 to 193 (67 residues), 30.8 bits, see alignment E=3.5e-11

Best Hits

KEGG orthology group: None (inferred from 73% identity to dar:Daro_2277)

Predicted SEED Role

"Putative protein-S-isoprenylcysteine methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK48 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Dsui_1079 putative protein-S-isoprenylcysteine methyltransferase (Dechlorosoma suillum PS)
MNHGQSGYGLWTLVFLNSAFFIFFAVSFFKPQTKQDWRTLGMFSAFLVALFTEMYGFPLT
IYLLSGWLTKYFPGIDWLSHDAGHLPEMLFGWKSNPHFGPFHLLSTVFILGGFLLLANAW
PVLYKAQRSSTLATEGPYRRIRHPQYLAFILIMFGFLLQWPTIITLLLFPLLVTTYVKLA
HREEQVGQAMFGEAWRDYAEHTPRWIPIIRVEETGDSA