Protein Info for Dsui_1073 in Dechlorosoma suillum PS

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 104 to 409 (306 residues), 142.5 bits, see alignment E=7.6e-46 PF16576: HlyD_D23" amino acids 114 to 335 (222 residues), 269.8 bits, see alignment E=3.3e-84 PF13437: HlyD_3" amino acids 233 to 332 (100 residues), 79.9 bits, see alignment E=5.5e-26 PF11604: CusF_Ec" amino acids 447 to 514 (68 residues), 91.5 bits, see alignment E=6.8e-30

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 71% identity to ajs:Ajs_2704)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK42 at UniProt or InterPro

Protein Sequence (528 amino acids)

>Dsui_1073 RND family efflux transporter, MFP subunit (Dechlorosoma suillum PS)
MNKGVISVAVVAVLAAGGGYWAGQNSGNAPHAHDTVASPTDSGKAERKILYYRNPMGLPD
TSQVPKKDPMGMDYIPVYEGEQDDEPASANQIKISTEKIQKLGVRTEAATLESLDKVVRA
AGRIEPDERRTYAISPKYEGYVERLYVNATGQAVGKGQPLFEVYSPELVSAQREYAIASQ
GLESMKSADDAAQSGMRQLADSSLTRLRNWDISEEQVKSLTKSGDAKRTLIFRSPVNGIV
AEKKAVQGMRFAPGDVLYQITDLGTVWVIADVFEQDIGWVKSGAKAKVKINAYPEKTFEG
TVSYVYPTLKADTRTIPVRLELPNPGNLLKPGMFAQVELPTIAKGAVVTIPNSAVIDSGT
RQIVLIQAKEGRFEPRDVKLGARSENRVEVIEGVREGEQVVVAANFLIDAESNLKAVVGG
FGHSGHGSSSPGAGQDKPVGVGYKAEGKVEDLDAKAGTVMLAHGAIPSLKWPAMTMEFKV
ANQSLLKDLKPGTPIKFEFVERSPGEWVVTTISPVAAVPVQANPHAGH