Protein Info for Dsui_1059 in Dechlorosoma suillum PS

Annotation: thiamine monophosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF00293: NUDIX" amino acids 7 to 107 (101 residues), 64.6 bits, see alignment E=1.4e-21 PF14815: NUDIX_4" amino acids 11 to 108 (98 residues), 59.3 bits, see alignment E=4.6e-20 PF02581: TMP-TENI" amino acids 134 to 314 (181 residues), 120.3 bits, see alignment E=9.6e-39

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 62% identity to app:CAP2UW1_0258)

Predicted SEED Role

"Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-) / Thiamin-phosphate pyrophosphorylase-like protein" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK28 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Dsui_1059 thiamine monophosphate synthase (Dechlorosoma suillum PS)
MSKVVEVSAAVIERNGGQEFLLACRPEGKVYAGYWEFPGGKVEAGESHRQALDRELQEEL
GITVTAATPWISRRFVYPHATVRLKFFRVTAWEGEIAPIEHSAFAWARIGMDAGVEPILP
ANGPILRALALPPLYALTQAEERGVEAEMARLERALAGGLKLVQVRDKQLPPAVRADFAA
RVVALAHAHGARALLNAPDEASDTLARRLGADGIHLPAARLQTLTARPDFPLVAASCHSP
EELALADRLELDFSVLGPVRPTPSHPEQAGLGWDVFGEWVFDCAQPVYALGGMTTAELET
ARRHGAQGIALMRGW