Protein Info for Dsui_1057 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF07072: ZapD" amino acids 16 to 224 (209 residues), 264.2 bits, see alignment E=4.6e-83

Best Hits

Swiss-Prot: 77% identical to ZAPD_DECAR: Cell division protein ZapD (zapD) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: None (inferred from 78% identity to app:CAP2UW1_0756)

Predicted SEED Role

"FIG002842: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJN4 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Dsui_1057 hypothetical protein (Dechlorosoma suillum PS)
MITYEYPFNERIRTLLRLEDLFDKAAYYLQAEGHLEHHVVLLTLFEILEVSRADLKMDLI
QELERQRQTLLAFRNNPDISEEALSGALYEIEQASAALLAMTGKIGQHLRDNEWLMSIKS
RAAIPGGVCEFDLPSYHFWQHHPAEQRRAALMGWLKPLLPLRDGLTIVLRLLRSSGRPKA
QVAPSGGFQLMLGGSNAQMVRVTLRDGDPAIPEISANKYALNIRFTCPDGDLKPRACDRE
VAFDMTFCNL