Protein Info for Dsui_1052 in Dechlorosoma suillum PS

Annotation: birA, biotin-(acetyl-CoA-carboxylase) ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 50 to 288 (239 residues), 152.5 bits, see alignment E=7.1e-49 PF03099: BPL_LplA_LipB" amino acids 63 to 179 (117 residues), 63.3 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 58% identity to app:CAP2UW1_0244)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJM9 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Dsui_1052 birA, biotin-(acetyl-CoA-carboxylase) ligase (Dechlorosoma suillum PS)
MGPEKFFLPGLIPDNGAFIPSGAVMAASLIDPALLVSRLGAIVGRVDVDSLESCDSTSSE
LSRRAARGAPAGSVVVADRQSAGRGRRGRDWVSSPEDSLTFSLLWRFAGGFDKVAGLSLA
VGVAVARACESLGAAGVVLKWPNDVLAPVPDGLGKLAGILVELSSSRRGTEAIIGIGINL
RAPAVSAPGGLAPAGLATLLGAVPERHDLLAALLRELVAVLDRFSRGGFAALADDWQRRH
AWQDCPVHLLEEGKVVASGLCRGADGDGALLLEGPDGVLRHLAGDLSLRPL