Protein Info for Dsui_1042 in Dechlorosoma suillum PS

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF03372: Exo_endo_phos" amino acids 10 to 241 (232 residues), 88.9 bits, see alignment E=2.1e-29

Best Hits

Swiss-Prot: 46% identical to YBHP_ECOL6: Uncharacterized protein YbhP (ybhP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06896, (no description) (inferred from 73% identity to dar:Daro_3767)

Predicted SEED Role

"Endonuclease/Exonuclease/phosphatase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJL9 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Dsui_1042 metal-dependent hydrolase (Dechlorosoma suillum PS)
MSRPTLHITTYNIHKGFSQFNRRMMVHELRERLRALGPDLVFLQEVQGLHLGHAEQHEHW
PEEPQHEFLAEDVWPDAAYGRNMVYDHGHHGNAILSRFPILSSHNQDVTHLRFERRGLLH
CEVQVPGWERHLHCVCVHLSLIGRSRRRQMDALAQRLEGLVPEDAPLIIAGDFNDWRNRA
DGLLAERLGLTEVFHGARGRPVRSYPAGLPLFRLDRIYARGFAVSATQVHFGRPWSRISD
HAALSAHLTPV