Protein Info for Dsui_1040 in Dechlorosoma suillum PS

Annotation: glutamyl-queuosine tRNA(Asp) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 8 to 281 (274 residues), 385 bits, see alignment E=9.7e-120 PF00749: tRNA-synt_1c" amino acids 9 to 248 (240 residues), 155 bits, see alignment E=1.2e-49

Best Hits

Swiss-Prot: 66% identical to GLUQ_DECAR: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 66% identity to dar:Daro_3769)

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJL7 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Dsui_1040 glutamyl-queuosine tRNA(Asp) synthetase (Dechlorosoma suillum PS)
MTRSPSAYRGRFAPSPSGPLHFGSLVAALGSCLEARCRQGEWLVRMEDVDGPRTVPGAAD
AILRSLEAYGFVWDGPVLWQSQRHEAYAAALARLQAAGLAYPCACSRKEIAEGHGGRSID
GAPRYAGTCRSGLQPGQSPRAWRLRLPDREVSFEDGLLGRVGHNLERDVGDIVLLRADGQ
YAYQLAVVVDDAFQGVTHVVRGADLLDSTPRQIWLQQCLGVPTPAYVHLPLATNARGEKL
SKQTRALALDDDRPVPALVDALEFLGQRPPPALRAASRDEVWAWAVAHWNLALVPRCRAV
SLE