Protein Info for Dsui_1027 in Dechlorosoma suillum PS

Annotation: RNA methyltransferase, RsmD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 23 to 196 (174 residues), 156.8 bits, see alignment E=2.6e-50 PF03602: Cons_hypoth95" amino acids 24 to 194 (171 residues), 176.7 bits, see alignment E=7.8e-56 PF05175: MTS" amino acids 54 to 147 (94 residues), 31.3 bits, see alignment E=3e-11 PF13847: Methyltransf_31" amino acids 67 to 170 (104 residues), 40 bits, see alignment E=6.5e-14 PF13649: Methyltransf_25" amino acids 69 to 162 (94 residues), 27.3 bits, see alignment E=9.9e-10

Best Hits

Swiss-Prot: 43% identical to RSMD_HAEIN: Ribosomal RNA small subunit methyltransferase D (rsmD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 70% identity to app:CAP2UW1_4010)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJK5 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Dsui_1027 RNA methyltransferase, RsmD family (Dechlorosoma suillum PS)
MARPGPQPAGRAGAARARAGNNVVRIIGGEWRRRVLSFPDGEGLRPTPDRVRETLFNWLG
QDLTGWNCLDLFAGSGALGFEAASRGAARSVLVERSPKAFAALKDNAALLQGENLQIIRE
DALKFVASTELRFDLVFLDPPYHLGWLEKLEPLLSRVLKEDGVIYAEAEKPLESLGDWAT
VKRGKAGQVFYHLMARNNADAE