Protein Info for Dsui_1022 in Dechlorosoma suillum PS

Annotation: cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 222 to 249 (28 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details PF18075: FtsX_ECD" amino acids 62 to 166 (105 residues), 68.8 bits, see alignment E=4.7e-23 PF02687: FtsX" amino acids 177 to 287 (111 residues), 35.5 bits, see alignment E=9.1e-13

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 64% identity to dar:Daro_3716)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJK0 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Dsui_1022 cell division protein (Dechlorosoma suillum PS)
MNAWLTQHLSALQGAWQRLAASPLNTVLSLLVIGIALTLPAAGVVVLDNLRQAAAGVAST
QQISVFLSPEASRKEATEMESRLRQEVSGSIVFVPREDALKRLQGTAGMAELVASLPRNP
LPDAFIVEPRNAAPEQLEALAKTLSAWPKVAHVQLDSAWIKRFDAFLRLGRLAVLLLAAA
FAAALVAVTFNTIRLQILAQADEIEVAKLIGATDGFIRRPYYYFGALQGILGGLIAMLLV
SAAVAVLSGPVSQLASLYATAFRLHGLGLDHSLLLLGVGALLGWLGAQLSVGLYLRQIEP
K